CK2 alpha antibody (70R-3651)

Rabbit polyclonal CK2 alpha antibody raised against the C terminal of CSNK2A2

Synonyms Polyclonal CK2 alpha antibody, Anti-CK2 alpha antibody, CK2 Alpha Prime Polypeptide antibody, CSNK2A1 antibody, CK2A2 antibody, Casein Kinase 2 Alpha Prime Polypeptide antibody, FLJ43934 antibody, CK 2, CK 2 antibody, CK-2 antibody, CSNK2A2 antibody, CK2, CK-2
Specificity CK2 alpha antibody was raised against the C terminal of CSNK2A2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CK2 alpha antibody was raised using the C terminal of CSNK2A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
Assay Information CK2 alpha Blocking Peptide, catalog no. 33R-3605, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody


Western Blot analysis using CK2 alpha antibody (70R-3651)

CK2 alpha antibody (70R-3651) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK2A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CK2 alpha antibody (70R-3651) | CK2 alpha antibody (70R-3651) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors