CKLF antibody (70R-6407)

Rabbit polyclonal CKLF antibody raised against the N terminal of CKLF

Synonyms Polyclonal CKLF antibody, Anti-CKLF antibody, HSPC224 antibody, CKLF3 antibody, CKLF1 antibody, CKLF2 antibody, CKLF4 antibody, UCK-1 antibody, C32 antibody, Chemokine-Like Factor antibody
Specificity CKLF antibody was raised against the N terminal of CKLF
Cross Reactivity Human
Applications WB
Immunogen CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG
Assay Information CKLF Blocking Peptide, catalog no. 33R-5854, is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Images

Western Blot analysis using CKLF antibody (70R-6407)

CKLF antibody (70R-6407) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CKLF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CKLF antibody (70R-6407) | CKLF antibody (70R-6407) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors