Claudin 15 antibody (70R-6175)

Rabbit polyclonal Claudin 15 antibody raised against the middle region of CLDN15

Synonyms Polyclonal Claudin 15 antibody, Anti-Claudin 15 antibody, CLDN15 antibody, Claudin 15, Claudin 15 antibody, Claudin -15, MGC19536 antibody, Claudin 15, FLJ42715 antibody, Claudin -15 antibody
Specificity Claudin 15 antibody was raised against the middle region of CLDN15
Cross Reactivity Human
Applications WB
Immunogen Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
Assay Information Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Images

Western Blot analysis using Claudin 15 antibody (70R-6175)

Claudin 15 antibody (70R-6175) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 15 antibody (70R-6175) | Claudin 15 antibody (70R-6175) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors