Claudin 16 antibody (70R-6033)

Rabbit polyclonal Claudin 16 antibody raised against the C terminal of CLDN16

Synonyms Polyclonal Claudin 16 antibody, Anti-Claudin 16 antibody, Claudin 16, Claudin 16 antibody, Claudin -16 antibody, Claudin -16, HOMG3 antibody, CLDN16 antibody, Claudin 16, PCLN1 antibody
Specificity Claudin 16 antibody was raised against the C terminal of CLDN16
Cross Reactivity Human
Applications WB
Immunogen Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Images

Western Blot analysis using Claudin 16 antibody (70R-6033)

Claudin 16 antibody (70R-6033) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 16 antibody (70R-6033) | Claudin 16 antibody (70R-6033) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors