Claudin 18 antibody (70R-6157)

Rabbit polyclonal Claudin 18 antibody raised against the middle region of CLDN18

Synonyms Polyclonal Claudin 18 antibody, Anti-Claudin 18 antibody, CLDN18 antibody, Claudin 18, Claudin -18 antibody, Claudin 18, Claudin 18 antibody, Claudin -18
Specificity Claudin 18 antibody was raised against the middle region of CLDN18
Cross Reactivity Human
Applications WB
Immunogen Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY
Assay Information Claudin 18 Blocking Peptide, catalog no. 33R-10119, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody


Western Blot analysis using Claudin 18 antibody (70R-6157)

Claudin 18 antibody (70R-6157) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Claudin 18 antibody (70R-6157) | Claudin 18 antibody (70R-6157) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors