Claudin 18 antibody (70R-6932)

Rabbit polyclonal Claudin 18 antibody raised against the C terminal of CLDN18

Synonyms Polyclonal Claudin 18 antibody, Anti-Claudin 18 antibody, Claudin -18, Claudin 18 antibody, CLDN18 antibody, Claudin 18, Claudin 18, Claudin -18 antibody
Specificity Claudin 18 antibody was raised against the C terminal of CLDN18
Cross Reactivity Human
Applications WB
Immunogen Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE
Assay Information Claudin 18 Blocking Peptide, catalog no. 33R-7040, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody


Western Blot analysis using Claudin 18 antibody (70R-6932)

Western Blot showing Claudin 18 antibody used at a concentration of 1-2 ug/ml to detect its target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Claudin 18 antibody (70R-6932) | Western Blot showing Claudin 18 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors