Claudin 19 antibody (70R-6184)

Rabbit polyclonal Claudin 19 antibody raised against the C terminal of CLDN19

Synonyms Polyclonal Claudin 19 antibody, Anti-Claudin 19 antibody, Claudin -19 antibody, Claudin 19 antibody, Claudin 19, CLDN19 antibody, Claudin 19, Claudin -19
Specificity Claudin 19 antibody was raised against the C terminal of CLDN19
Cross Reactivity Human
Applications WB
Immunogen Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
Assay Information Claudin 19 Blocking Peptide, catalog no. 33R-1605, is also available for use as a blocking control in assays to test for specificity of this Claudin 19 antibody

Images

Western Blot analysis using Claudin 19 antibody (70R-6184)

Claudin 19 antibody (70R-6184) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 19 antibody (70R-6184) | Claudin 19 antibody (70R-6184) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors