Claudin 23 antibody (70R-6102)

Rabbit polyclonal Claudin 23 antibody raised against the C terminal of CLDN23

Synonyms Polyclonal Claudin 23 antibody, Anti-Claudin 23 antibody, Claudin 23, Claudin 23, Claudin -23 antibody, CLDN23 antibody, hCG1646163 antibody, Claudin -23, CLDNL antibody, Claudin 23 antibody
Specificity Claudin 23 antibody was raised against the C terminal of CLDN23
Cross Reactivity Human
Applications WB
Immunogen Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
Assay Information Claudin 23 Blocking Peptide, catalog no. 33R-4034, is also available for use as a blocking control in assays to test for specificity of this Claudin 23 antibody

Images

Western Blot analysis using Claudin 23 antibody (70R-6102)

Claudin 23 antibody (70R-6102) used at 0.2-0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 23 antibody (70R-6102) | Claudin 23 antibody (70R-6102) used at 0.2-0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors