Claudin 5 antibody (70R-6137)

Rabbit polyclonal Claudin 5 antibody

Synonyms Polyclonal Claudin 5 antibody, Anti-Claudin 5 antibody, AWAL antibody, BEC1 antibody, CPETRL1 antibody, CLDN5 antibody, Claudin 5, Claudin -5, Claudin -5 antibody, Claudin 5 antibody, Claudin 5, Transmembrane Protein Deleted In Velocardiofacial Syndrome antibody, TMVCF antibody
Cross Reactivity Human
Applications WB
Immunogen Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
Assay Information Claudin 5 Blocking Peptide, catalog no. 33R-3663, is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody

Images

Western Blot analysis using Claudin 5 antibody (70R-6137)

Claudin 5 antibody (70R-6137) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 5 antibody (70R-6137) | Claudin 5 antibody (70R-6137) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors