Claudin 7 antibody (70R-7478)

Rabbit polyclonal Claudin 7 antibody raised against the C terminal of CLDN7

Synonyms Polyclonal Claudin 7 antibody, Anti-Claudin 7 antibody, CEPTRL2 antibody, Claudin -7 antibody, Claudin 7 antibody, Claudin -7, CPETRL2 antibody, claudin-1 antibody, Claudin 7, Hs.84359 antibody, CLDN7 antibody, Claudin 7
Specificity Claudin 7 antibody was raised against the C terminal of CLDN7
Cross Reactivity Human
Applications WB
Immunogen Claudin 7 antibody was raised using the C terminal of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Assay Information Claudin 7 Blocking Peptide, catalog no. 33R-3465, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody

Images

Western Blot analysis using Claudin 7 antibody (70R-7478)

Claudin 7 antibody (70R-7478) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 7 antibody (70R-7478) | Claudin 7 antibody (70R-7478) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors