Claudin 8 antibody (70R-1695)

Rabbit polyclonal Claudin 8 antibody raised against the C terminal of CLDN8

Synonyms Polyclonal Claudin 8 antibody, Anti-Claudin 8 antibody, Claudin -8 antibody, CLDN8 antibody, Claudin 8, Claudin -8, Claudin 8, Claudin 8 antibody
Specificity Claudin 8 antibody was raised against the C terminal of CLDN8
Cross Reactivity Human
Applications IHC, WB
Immunogen Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Assay Information Claudin 8 Blocking Peptide, catalog no. 33R-4198, is also available for use as a blocking control in assays to test for specificity of this Claudin 8 antibody

Images

Western Blot analysis using Claudin 8 antibody (70R-1695)

Claudin 8 antibody (70R-1695) used at 0.5-1.0 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5-1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Claudin 8 antibody (70R-1695) | Claudin 8 antibody (70R-1695) used at 0.5-1.0 ug/ml to detect target protein.
  • Immunohistochemical staining using Claudin 8 antibody (70R-1695) | Claudin 8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors