CLCN6 antibody (70R-1521)

Rabbit polyclonal CLCN6 antibody raised against the C terminal of CLCN6

Synonyms Polyclonal CLCN6 antibody, Anti-CLCN6 antibody, Chloride Channel 6 antibody
Specificity CLCN6 antibody was raised against the C terminal of CLCN6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
Assay Information CLCN6 Blocking Peptide, catalog no. 33R-7295, is also available for use as a blocking control in assays to test for specificity of this CLCN6 antibody


Western Blot analysis using CLCN6 antibody (70R-1521)

CLCN6 antibody (70R-1521) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLCN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CLCN6 antibody (70R-1521) | CLCN6 antibody (70R-1521) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors