CLEC4M antibody (70R-6089)

Rabbit polyclonal CLEC4M antibody raised against the n terminal of CLEC4M

Synonyms Polyclonal CLEC4M antibody, Anti-CLEC4M antibody, DC-SIGN2 antibody, DC-SIGNR antibody, CD209L antibody, DCSIGNR antibody, HP10347 antibody, CD299 antibody, L-SIGN antibody, LSIGN antibody, MGC47866 antibody, C-Type Lectin Domain Family 4 Member M antibody, MGC129964 antibody
Specificity CLEC4M antibody was raised against the n terminal of CLEC4M
Cross Reactivity Human
Applications WB
Immunogen CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
Assay Information CLEC4M Blocking Peptide, catalog no. 33R-6413, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Images

Western Blot analysis using CLEC4M antibody (70R-6089)

CLEC4M antibody (70R-6089) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLEC4M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLEC4M antibody (70R-6089) | CLEC4M antibody (70R-6089) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors