CLIC1 antibody (70R-1489)

Rabbit polyclonal CLIC1 antibody raised against the C terminal of CLIC1

Synonyms Polyclonal CLIC1 antibody, Anti-CLIC1 antibody, CLIC 1 antibody, CLIC-1, CLIC1, CLIC-1 antibody, CLIC 1, Chloride Intracellular Channel 1 antibody
Specificity CLIC1 antibody was raised against the C terminal of CLIC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
Assay Information CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody


Western Blot analysis using CLIC1 antibody (70R-1489)

CLIC1 antibody (70R-1489) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLIC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CLIC1 antibody (70R-1489) | CLIC1 antibody (70R-1489) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors