CLIC3 Blocking Peptide (33R-10363)

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIC3 antibody, catalog no. 70R-8068

Synonyms CLIC3 control peptide, CLIC3 antibody Blocking Peptide, Anti-CLIC3 Blocking Peptide, chloride intracellular channel 3 Blocking Peptide, CLIC3, CLIC-3, CLIC 3, CLIC-3 Blocking Peptide, CLIC 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors