CLIC5 antibody (70R-1515)

Rabbit polyclonal CLIC5 antibody raised against the middle region of CLIC5

Synonyms Polyclonal CLIC5 antibody, Anti-CLIC5 antibody, CLIC 5 antibody, CLIC-5 antibody, Chloride Intracellular Channel 5 antibody, CLIC-5, CLIC 5, CLIC5
Specificity CLIC5 antibody was raised against the middle region of CLIC5
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
Assay Information CLIC5 Blocking Peptide, catalog no. 33R-3815, is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Images

Immunohistochemical staining using CLIC5 antibody (70R-1515)

CLIC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLIC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CLIC5 antibody (70R-1515) | CLIC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using CLIC5 antibody (70R-1515) | CLIC5 antibody (70R-1515) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors