CLIC5 antibody (70R-5082)

Rabbit polyclonal CLIC5 antibody raised against the C terminal of CLIC5

Synonyms Polyclonal CLIC5 antibody, Anti-CLIC5 antibody, CLIC 5 antibody, CLIC-5 antibody, CLIC 5, CLIC5, Chloride Intracellular Channel 5 antibody, CLIC-5
Specificity CLIC5 antibody was raised against the C terminal of CLIC5
Cross Reactivity Human
Applications IHC, WB
Immunogen CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Images

Immunohistochemical staining using CLIC5 antibody (70R-5082)

CLIC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLIC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CLIC5 antibody (70R-5082) | CLIC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
  • Western Blot analysis using CLIC5 antibody (70R-5082) | CLIC5 antibody (70R-5082) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors