CLN6 antibody (70R-6316)

Rabbit polyclonal CLN6 antibody raised against the C terminal of CLN6

Synonyms Polyclonal CLN6 antibody, Anti-CLN6 antibody, CLN-6 antibody, CLN 6, CLN6, CLN-6, HsT18960 antibody, FLJ20561 antibody, CLN 6 antibody, nclf antibody, Ceroid-Lipofuscinosis Neuronal 6 Late Infantile Variant antibody
Specificity CLN6 antibody was raised against the C terminal of CLN6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA
Assay Information CLN6 Blocking Peptide, catalog no. 33R-8022, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody

Images

Western Blot analysis using CLN6 antibody (70R-6316)

CLN6 antibody (70R-6316) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLN6 antibody (70R-6316) | CLN6 antibody (70R-6316) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors