CLN6 antibody (70R-6557)

Rabbit polyclonal CLN6 antibody raised against the middle region of CLN6

Synonyms Polyclonal CLN6 antibody, Anti-CLN6 antibody, CLN 6 antibody, FLJ20561 antibody, CLN 6, CLN-6, Ceroid-Lipofuscinosis Neuronal 6 Late Infantile Variant antibody, CLN6, nclf antibody, CLN-6 antibody, HsT18960 antibody
Specificity CLN6 antibody was raised against the middle region of CLN6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
Assay Information CLN6 Blocking Peptide, catalog no. 33R-5287, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody

Images

Western Blot analysis using CLN6 antibody (70R-6557)

CLN6 antibody (70R-6557) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLN6 antibody (70R-6557) | CLN6 antibody (70R-6557) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors