CLN8 antibody (70R-7115)

Rabbit polyclonal CLN8 antibody

Synonyms Polyclonal CLN8 antibody, Anti-CLN8 antibody, CLN 8 antibody, CLN 8, Ceroid-Lipofuscinosis Neuronal 8 antibody, Epilepsy antibody, CLN-8, CLN8, C8orf61 antibody, CLN-8 antibody, FLJ39417 antibody, EPMR antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV
Assay Information CLN8 Blocking Peptide, catalog no. 33R-9526, is also available for use as a blocking control in assays to test for specificity of this CLN8 antibody

Images

Western Blot analysis using CLN8 antibody (70R-7115)

CLN8 antibody (70R-7115) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLN8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLN8 is a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLN8 antibody (70R-7115) | CLN8 antibody (70R-7115) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors