CLPB antibody (70R-3956)

Rabbit polyclonal CLPB antibody

Synonyms Polyclonal CLPB antibody, Anti-CLPB antibody, Clpb Caseinolytic Peptidase B Homolog antibody, HSP78 antibody, SKD3 antibody, FLJ13152 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH
Assay Information CLPB Blocking Peptide, catalog no. 33R-2555, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody


Western Blot analysis using CLPB antibody (70R-3956)

CLPB antibody (70R-3956) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLPB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CLPB antibody (70R-3956) | CLPB antibody (70R-3956) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors