Clusterin-Like 1 antibody (70R-3976)

Rabbit polyclonal Clusterin-Like 1 antibody

Synonyms Polyclonal Clusterin-Like 1 antibody, Anti-Clusterin-Like 1 antibody, CLUL1 antibody, RA337M antibody
Cross Reactivity Human
Applications WB
Immunogen Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES
Assay Information Clusterin-Like 1 Blocking Peptide, catalog no. 33R-9042, is also available for use as a blocking control in assays to test for specificity of this Clusterin-Like 1 antibody


Western Blot analysis using Clusterin-Like 1 antibody (70R-3976)

Clusterin-Like 1 antibody (70R-3976) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLUL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLUL1 is a secreted clusterin family glycoprotein that is expressed predominantly by cone photoreceptors of the retina. CLUL1 expression is downregulated in some forms of retinal disease.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Clusterin-Like 1 antibody (70R-3976) | Clusterin-Like 1 antibody (70R-3976) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors