CMTM8 antibody (70R-6363)

Rabbit polyclonal CMTM8 antibody raised against the middle region of CMTM8

Synonyms Polyclonal CMTM8 antibody, Anti-CMTM8 antibody, CKLFSF8 antibody, CKLFSF8-V2 antibody, Cklf-Like Marvel Transmembrane Domain Containing 8 antibody
Specificity CMTM8 antibody was raised against the middle region of CMTM8
Cross Reactivity Human
Applications WB
Immunogen CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
Assay Information CMTM8 Blocking Peptide, catalog no. 33R-1686, is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody


Western Blot analysis using CMTM8 antibody (70R-6363)

CMTM8 antibody (70R-6363) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CMTM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CMTM8 antibody (70R-6363) | CMTM8 antibody (70R-6363) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors