CNDP2 antibody (70R-4085)

Rabbit polyclonal CNDP2 antibody

Synonyms Polyclonal CNDP2 antibody, Anti-CNDP2 antibody, HsT2298 antibody, PEPA antibody, CPGL antibody, Cndp Dipeptidase 2 antibody, Metallopeptidase M20 Family antibody, FLJ10830 antibody, CN2 antibody
Cross Reactivity Human
Applications WB
Immunogen CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC
Assay Information CNDP2 Blocking Peptide, catalog no. 33R-1325, is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody


Western Blot analysis using CNDP2 antibody (70R-4085)

CNDP2 antibody (70R-4085) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNDP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNDP2, also known as tissue carnosinase and peptidase A (EC, is a nonspecific dipeptidase rather than a selective carnosinase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CNDP2 antibody (70R-4085) | CNDP2 antibody (70R-4085) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors