CNOT6 antibody (70R-4950)

Rabbit polyclonal CNOT6 antibody raised against the N terminal of CNOT6

Synonyms Polyclonal CNOT6 antibody, Anti-CNOT6 antibody, KIAA1194 antibody, Ccr4-Not Transcription Complex Subunit 6 antibody, CCR4 antibody
Specificity CNOT6 antibody was raised against the N terminal of CNOT6
Cross Reactivity Human
Applications WB
Immunogen CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN
Assay Information CNOT6 Blocking Peptide, catalog no. 33R-2486, is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody


Western Blot analysis using CNOT6 antibody (70R-4950)

CNOT6 antibody (70R-4950) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNOT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CNOT6 antibody (70R-4950) | CNOT6 antibody (70R-4950) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors