CNP antibody (70R-1054)

Rabbit polyclonal CNP antibody raised against the N terminal of CNP

Synonyms Polyclonal CNP antibody, Anti-CNP antibody, 2'3'-Cyclic Nucleotide 3' Phosphodiesterase antibody
Specificity CNP antibody was raised against the N terminal of CNP
Cross Reactivity Human
Applications WB
Immunogen CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Assay Information CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Images

Western Blot analysis using CNP antibody (70R-1054)

CNP antibody (70R-1054) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CNP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CNP antibody (70R-1054) | CNP antibody (70R-1054) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors