CNP antibody (70R-2044)

Rabbit polyclonal CNP antibody raised against the middle region of CNP

Synonyms Polyclonal CNP antibody, Anti-CNP antibody, CNP1 antibody, 2'3'-Cyclic Nucleotide 3' Phosphodiesterase antibody
Specificity CNP antibody was raised against the middle region of CNP
Cross Reactivity Human
Applications WB
Immunogen CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
Assay Information CNP Blocking Peptide, catalog no. 33R-5574, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Images

Western Blot analysis using CNP antibody (70R-2044)

CNP antibody (70R-2044) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CNP antibody (70R-2044) | CNP antibody (70R-2044) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors