CNR1 Blocking Peptide (33R-1102)

A synthetic peptide for use as a blocking control in assays to test for specificity of CNR1 antibody, catalog no. 70R-9961

Synonyms CNR1 control peptide, CNR1 antibody Blocking Peptide, Anti-CNR1 Blocking Peptide, cannabinoid receptor 1, brain Blocking Peptide, CANN6 Blocking Peptide, CB-R Blocking Peptide, CB1 Blocking Peptide, CB1A Blocking Peptide, CB1K5 Blocking Peptide, CB1R Blocking Peptide, CNR Blocking Peptide, CNR1, CNR-1, CNR 1, CNR-1 Blocking Peptide, CNR 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors