CNTNAP3 antibody (70R-6145)

Rabbit polyclonal CNTNAP3 antibody raised against the middle region of CNTNAP3

Synonyms Polyclonal CNTNAP3 antibody, Anti-CNTNAP3 antibody, RP11-138L21.1 antibody, CNTNAP3A antibody, RP11-290L7.1 antibody, CASPR3 antibody, Contactin Associated Protein-Like 3 antibody
Specificity CNTNAP3 antibody was raised against the middle region of CNTNAP3
Cross Reactivity Human
Applications WB
Immunogen CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
Assay Information CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Images

Western Blot analysis using CNTNAP3 antibody (70R-6145)

CNTNAP3 antibody (70R-6145) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNTNAP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CNTNAP3 antibody (70R-6145) | CNTNAP3 antibody (70R-6145) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors