CNTNAP4 antibody (70R-6128)

Rabbit polyclonal CNTNAP4 antibody raised against the N terminal of CNTNAP4

Synonyms Polyclonal CNTNAP4 antibody, Anti-CNTNAP4 antibody, Contactin Associated Protein-Like 4 antibody, KIAA1763 antibody, CASPR4 antibody
Specificity CNTNAP4 antibody was raised against the N terminal of CNTNAP4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
Assay Information CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody

Images

Western Blot analysis using CNTNAP4 antibody (70R-6128)

CNTNAP4 antibody (70R-6128) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 145 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNTNAP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CNTNAP4 antibody (70R-6128) | CNTNAP4 antibody (70R-6128) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors