Cobl-Like 1 antibody (70R-3863)

Rabbit polyclonal Cobl-Like 1 antibody raised against the N terminal of COBLL1

Synonyms Polyclonal Cobl-Like 1 antibody, Anti-Cobl-Like 1 antibody, KIAA0977 antibody, COBLL1 antibody
Specificity Cobl-Like 1 antibody was raised against the N terminal of COBLL1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
Assay Information Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Images

Immunohistochemical staining using Cobl-Like 1 antibody (70R-3863)

Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 128 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COBLL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this gene remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Cobl-Like 1 antibody (70R-3863) | Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Cobl-Like 1 antibody (70R-3863) | Cobl-Like 1 antibody (70R-3863) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using Cobl-Like 1 antibody (70R-3863) | Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors