Collagen Type IV alpha 3 antibody (70R-5733)

Rabbit polyclonal Collagen Type IV alpha 3 antibody

Synonyms Polyclonal Collagen Type IV alpha 3 antibody, Anti-Collagen Type IV alpha 3 antibody, CERT antibody, Arresten antibody, CERTL antibody, Canstatin antibody, COL4A3BP antibody, FLJ20597 antibody, STARD11 antibody, Goodpasture Antigen Binding Protein antibody, GPBP antibody, Collagen Of Basement Membrane Alpha 3 Chain antibody
Cross Reactivity Human
Applications WB
Immunogen Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
Assay Information Collagen Type IV alpha 3 Blocking Peptide, catalog no. 33R-7287, is also available for use as a blocking control in assays to test for specificity of this Collagen Type IV alpha 3 antibody

Images

Western Blot analysis using Collagen Type IV alpha 3 antibody (70R-5733)

Collagen Type IV alpha 3 antibody (70R-5733) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COL4A3BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Collagen Type IV alpha 3 antibody (70R-5733) | Collagen Type IV alpha 3 antibody (70R-5733) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors