Collagen Type VI Alpha 1 antibody (70R-6043)

Rabbit polyclonal Collagen Type VI Alpha 1 antibody raised against the middle region of COL6A1

Synonyms Polyclonal Collagen Type VI Alpha 1 antibody, Anti-Collagen Type VI Alpha 1 antibody, COL6A1 antibody, OPLL antibody
Specificity Collagen Type VI Alpha 1 antibody was raised against the middle region of COL6A1
Cross Reactivity Human
Applications WB
Immunogen Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Assay Information Collagen Type VI Alpha 1 Blocking Peptide, catalog no. 33R-1097, is also available for use as a blocking control in assays to test for specificity of this Collagen Type VI Alpha 1 antibody

Images

Western Blot analysis using Collagen Type VI Alpha 1 antibody (70R-6043)

Collagen Type VI Alpha 1 antibody (70R-6043) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COL6A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Collagen Type VI Alpha 1 antibody (70R-6043) | Collagen Type VI Alpha 1 antibody (70R-6043) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors