Collagen Type VI Alpha 1 Blocking Peptide (33R-1097)

A synthetic peptide for use as a blocking control in assays to test for specificity of COL6A1 antibody, catalog no. 70R-6043

Synonyms Collagen Type VI Alpha 1 control peptide, Collagen Type VI Alpha 1 antibody Blocking Peptide, Anti-Collagen Type VI Alpha 1 Blocking Peptide, OPLL Blocking Peptide, COL6A1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Molecular Weight 106 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors