Complement C2 antibody (70R-1657)

Rabbit polyclonal Complement C2 antibody raised against the middle region of C2

Synonyms Polyclonal Complement C2 antibody, Anti-Complement C2 antibody, Complement C-2, CO2 antibody, Complement C-2 antibody, Complement C2, DKFZp779M0311 antibody, C2 antibody, Complement C 2, Complement C 2 antibody
Specificity Complement C2 antibody was raised against the middle region of C2
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
Assay Information Complement C2 Blocking Peptide, catalog no. 33R-4079, is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody


Western Blot analysis using Complement C2 antibody (70R-1657)

Complement C2 antibody (70R-1657) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Complement C2 antibody (70R-1657) | Complement C2 antibody (70R-1657) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
View Our Distributors