COMT antibody (70R-7143)

Rabbit polyclonal COMT antibody raised against the middle region of COMT

Synonyms Polyclonal COMT antibody, Anti-COMT antibody, Catechol-O-Methyltransferase antibody
Specificity COMT antibody was raised against the middle region of COMT
Cross Reactivity Human
Applications WB
Immunogen COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
Assay Information COMT Blocking Peptide, catalog no. 33R-7005, is also available for use as a blocking control in assays to test for specificity of this COMT antibody

Images

Western Blot analysis using COMT antibody (70R-7143)

COMT antibody (70R-7143) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COMT antibody (70R-7143) | COMT antibody (70R-7143) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors