COPA antibody (70R-6205)

Rabbit polyclonal COPA antibody raised against the middle region of COPA

Synonyms Polyclonal COPA antibody, Anti-COPA antibody, HEP-COP antibody, Coatomer Protein Complex Subunit Alpha antibody, FLJ26320 antibody
Specificity COPA antibody was raised against the middle region of COPA
Cross Reactivity Human,Mouse
Applications WB
Immunogen COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT
Assay Information COPA Blocking Peptide, catalog no. 33R-4092, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Images

Western Blot analysis using COPA antibody (70R-6205)

COPA antibody (70R-6205) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 135 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COPA antibody (70R-6205) | COPA antibody (70R-6205) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors