COQ2 antibody (70R-6520)

Rabbit polyclonal COQ2 antibody

Synonyms Polyclonal COQ2 antibody, Anti-COQ2 antibody, COQ-2, COQ 2, COQ 2 antibody, FLJ26072 antibody, Coenzyme Q2 Homolog Prenyltransferase antibody, CL640 antibody, COQ2, COQ-2 antibody
Cross Reactivity Human
Applications WB
Immunogen COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Assay Information COQ2 Blocking Peptide, catalog no. 33R-3061, is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody

Images

Western Blot analysis using COQ2 antibody (70R-6520)

COQ2 antibody (70R-6520) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COQ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COQ2 antibody (70R-6520) | COQ2 antibody (70R-6520) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors