Corticosteroid Binding Globulin protein (80-1593)

Purified recombinant Corticosteroid Binding Globulin protein (GST tag)

Synonyms Serpin A6 protein, Transcortin protein, CBG protein, SERPINA6 protein, Corticosteroid-binding Globulin protein
Species Human
Protein Type Recombinant

Images

SDS-PAGE analysis of Corticosteroid Binding Globulin protein (30-1340)

Specifications

Residues Expression Region: 23-405 with N terminal GST tag; AA Sequence: MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFI SPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQG FQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYE SEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAI LVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQS STISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAAL SRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGST GVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
Expression System E.coli
Purity > 90% pure
Tag/Conjugate GST tag
Form & Buffer Supplied in PBS buffer,pH 7.4 with 50% glycerol

Storage & Safety

Storage Store at -20 deg c or -80 deg c for long term storage

General Information

Biological Significance Corticosteroid Binding Globulin is a major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • SDS-PAGE analysis of Corticosteroid Binding Globulin protein (30-1340)

Availability: In stock

Price: $395.00
Size: 200 ug
OR
Shipping
View Our Distributors