COX10 antibody (70R-6465)

Rabbit polyclonal COX10 antibody raised against the middle region of COX10

Synonyms Polyclonal COX10 antibody, Anti-COX10 antibody, Cox10 Homolog Cytochrome C Oxidase Assembly Protein Heme A antibody
Specificity COX10 antibody was raised against the middle region of COX10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG
Assay Information COX10 Blocking Peptide, catalog no. 33R-1421, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody


Western Blot analysis using COX10 antibody (70R-6465)

COX10 antibody (70R-6465) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using COX10 antibody (70R-6465) | COX10 antibody (70R-6465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors