COX10 antibody (70R-6479)

Rabbit polyclonal COX10 antibody raised against the middle region of COX10

Synonyms Polyclonal COX10 antibody, Anti-COX10 antibody, Cox10 Homolog Cytochrome C Oxidase Assembly Protein antibody
Specificity COX10 antibody was raised against the middle region of COX10
Cross Reactivity Human
Applications WB
Immunogen COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL
Assay Information COX10 Blocking Peptide, catalog no. 33R-2170, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody

Images

Western Blot analysis using COX10 antibody (70R-6479)

COX10 antibody (70R-6479) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COX10 antibody (70R-6479) | COX10 antibody (70R-6479) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors