COX18 antibody (70R-6523)

Rabbit polyclonal COX18 antibody

Synonyms Polyclonal COX18 antibody, Anti-COX18 antibody, COX18HS antibody, FLJ38991 antibody, MGC126733 antibody, Cox18 Cytochrome C Oxidase Assembly Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
Assay Information COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody

Images

Western Blot analysis using COX18 antibody (70R-6523)

COX18 antibody (70R-6523) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COX18 antibody (70R-6523) | COX18 antibody (70R-6523) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors