COX3 antibody (70R-7026)

Rabbit polyclonal COX3 antibody raised against the C terminal of COX3

Synonyms Polyclonal COX3 antibody, Anti-COX3 antibody, MTCO3 antibody, Cytochrome C Oxidase Iii antibody
Specificity COX3 antibody was raised against the C terminal of COX3
Cross Reactivity Human
Applications WB
Immunogen COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH
Assay Information COX3 Blocking Peptide, catalog no. 33R-2880, is also available for use as a blocking control in assays to test for specificity of this COX3 antibody

Images

Western Blot analysis using COX3 antibody (70R-7026)

COX3 antibody (70R-7026) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COX3 antibody (70R-7026) | COX3 antibody (70R-7026) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors