COX7B antibody (70R-4528)

Rabbit polyclonal COX7B antibody raised against the N terminal of COX7B

Synonyms Polyclonal COX7B antibody, Anti-COX7B antibody, Cytochrome C Oxidase Subunit Viib antibody
Specificity COX7B antibody was raised against the N terminal of COX7B
Cross Reactivity Human
Applications WB
Immunogen COX7B antibody was raised using the N terminal of COX7B corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI
Assay Information COX7B Blocking Peptide, catalog no. 33R-6000, is also available for use as a blocking control in assays to test for specificity of this COX7B antibody


Western Blot analysis using COX7B antibody (70R-4528)

COX7B antibody (70R-4528) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 6 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX7B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using COX7B antibody (70R-4528) | COX7B antibody (70R-4528) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors