CPEB3 antibody (70R-4412)

Rabbit polyclonal CPEB3 antibody raised against the middle region of CPEB3

Synonyms Polyclonal CPEB3 antibody, Anti-CPEB3 antibody, Cytoplasmic Polyadenylation Element Binding Protein 3 antibody
Specificity CPEB3 antibody was raised against the middle region of CPEB3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG
Assay Information CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody


Western Blot analysis using CPEB3 antibody (70R-4412)

CPEB3 antibody (70R-4412) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPEB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CPEB3 antibody (70R-4412) | CPEB3 antibody (70R-4412) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors