CPS1 antibody (70R-1111)

Rabbit polyclonal CPS1 antibody raised against the N terminal of CPS1

Synonyms Polyclonal CPS1 antibody, Anti-CPS1 antibody, Carbamoyl-Phosphate Synthetase 1 Mitochondrial antibody
Specificity CPS1 antibody was raised against the N terminal of CPS1
Cross Reactivity Human
Applications IHC, WB
Immunogen CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
Assay Information CPS1 Blocking Peptide, catalog no. 33R-7787, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody

Images

Western Blot analysis using CPS1 antibody (70R-1111)

CPS1 antibody (70R-1111) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 165 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CPS1 antibody (70R-1111) | CPS1 antibody (70R-1111) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using CPS1 antibody (70R-1111) | CPS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors