CPT1A antibody (70R-6516)

Rabbit polyclonal CPT1A antibody

Synonyms Polyclonal CPT1A antibody, Anti-CPT1A antibody, L-CPT1 antibody, CPT1 antibody, CPT1, Carnitine Palmitoyltransferase 1A antibody, CPT-1, CPT 1, CPT 1 antibody, CPT1-L antibody, CPT-1 antibody
Cross Reactivity Human
Applications WB
Immunogen CPT1A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
Assay Information CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Images

Western Blot analysis using CPT1A antibody (70R-6516)

CPT1A antibody (70R-6516) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPT1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CPT1A antibody (70R-6516) | CPT1A antibody (70R-6516) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors