CREG2 antibody (70R-5475)

Rabbit polyclonal CREG2 antibody raised against the N terminal of CREG2

Synonyms Polyclonal CREG2 antibody, Anti-CREG2 antibody, Cellular Repressor Of E1A-Stimulated Genes 2 antibody
Specificity CREG2 antibody was raised against the N terminal of CREG2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
Assay Information CREG2 Blocking Peptide, catalog no. 33R-9827, is also available for use as a blocking control in assays to test for specificity of this CREG2 antibody

Images

Western Blot analysis using CREG2 antibody (70R-5475)

CREG2 antibody (70R-5475) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CREG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CREG2 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CREG2 antibody (70R-5475) | CREG2 antibody (70R-5475) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors