CRISPLD2 antibody (70R-7445)

Rabbit polyclonal CRISPLD2 antibody raised against the N terminal of CRISPLD2

Synonyms Polyclonal CRISPLD2 antibody, Anti-CRISPLD2 antibody, DKFZP434B044 antibody, CRISP11 antibody, Cysteine-Rich Secretory Protein Lccl Domain Containing 2 antibody, LCRISP2 antibody, MGC74865 antibody
Specificity CRISPLD2 antibody was raised against the N terminal of CRISPLD2
Cross Reactivity Human
Applications WB
Immunogen CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
Assay Information CRISPLD2 Blocking Peptide, catalog no. 33R-6404, is also available for use as a blocking control in assays to test for specificity of this CRISPLD2 antibody

Images

Western Blot analysis using CRISPLD2 antibody (70R-7445)

CRISPLD2 antibody (70R-7445) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRISPLD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRISPLD2 is a novel NSCLP candidate gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CRISPLD2 antibody (70R-7445) | CRISPLD2 antibody (70R-7445) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors