CRLF1 antibody (70R-5737)

Rabbit polyclonal CRLF1 antibody raised against the middle region of CRLF1

Synonyms Polyclonal CRLF1 antibody, Anti-CRLF1 antibody, CISS antibody, CISS1 antibody, CLF-1 antibody, NR6 antibody, Cytokine Receptor-Like Factor 1 antibody, CLF antibody
Specificity CRLF1 antibody was raised against the middle region of CRLF1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
Assay Information CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody


Western Blot analysis using CRLF1 antibody (70R-5737)

CRLF1 antibody (70R-5737) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRLF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRLF1 antibody (70R-5737) | CRLF1 antibody (70R-5737) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors